PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT29321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 169aa    MW: 19174.7 Da    PI: 10.1932
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT29321genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048e-3390148159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK vk++++prsYY+Ct++gC+vkk+v+r ++d+ vv++tYeg H+h+
  OIT29321  90 LDDGYRWRKYGQKAVKNNNYPRSYYKCTHQGCNVKKQVQRLSKDGGVVVTTYEGMHTHP 148
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    
MENQSMSFLG STGCYNSMNG WISGLKTEIS NSTARDQQNV SNIKNSPVAV GVVSSETHTT  60
NIISSLKKKG DKKIRKPRFA FQTRSQVDIL DDGYRWRKYG QKAVKNNNYP RSYYKCTHQG  120
CNVKKQVQRL SKDGGVVVTT YEGMHTHPID KPTDNFEQIL HQMHIIPPH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01970.15e-52WRKY family protein