PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT28812
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 309aa    MW: 33387.6 Da    PI: 5.4473
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT28812genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.2e-33164221259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  OIT28812 164 EDGYRWRKYGQKAVKNSPFPRSYYRCTNTKCTVKKRVERSSEDPSIVITTYEGQHCHH 221
               8******************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    
MDDKDKVNDP LKSAAEFDAT ESSWSLGADS DNVYSFFGNT DRDNSILNEF GWNFAPSEAA  60
GDKDIAGGSG GAGGFDRIDD DLAGNSSTTP SASATEVPAT GKITDEPVSS SCSDDPPEKS  120
TASGGSSASR PPSDTASKVK KKGQKRIRQP RFAFMTKSEV DHLEDGYRWR KYGQKAVKNS  180
PFPRSYYRCT NTKCTVKKRV ERSSEDPSIV ITTYEGQHCH HTVGFPRGGL ISHEAAFTTH  240
QLSPLASQFY LPGGVQYPQE VPMSAPESRQ IPGESVEARR LPETSQPANQ LPTDEGLLGD  300
IVPPGMRSR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-66WRKY family protein