PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT27991
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 611aa    MW: 65921.8 Da    PI: 6.586
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT27991genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY992.9e-31256313260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  OIT27991 256 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 313
               8****************************************.***************85 PP

2WRKY106.11.8e-33427485159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  OIT27991 427 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 485
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    
MEDSQSQSQS QSHYSQQYSH SSPLPSINES SEQQLKISSC DASAVGSNSS RGAKYRLMSP  60
AKLPISRSAC ITIPPGLSPS SFLESPVLLS NIKAEPSPTT GSFSKFQLMQ GSSGSAAFSF  120
MRSCSSGNAY GETTGEFEFK FAVGSSSTSG SVAKEAATFA GLNQQQSEPL NQIQDRCLSQ  180
SFAPSALVKS EMPNSKEVSL PAPVSLDASS ISTAAADAAA IDNEEISQRG HSNPSSQGSH  240
ADNRDVSSIT AERSSDDGYN WRKYGQKLVK GSEFPRSYYK CTYPNCEVKK IFERSPEGQI  300
TEIVYKGSHD HPKPQPSRRF TPGALTSIQE DRSEKEASFT GQEDKFNTNA YASNIEPSST  360
PVSPRLADDD GLEGTVSQLQ SANDQLDEDD PFAKRRKMDG GMDITPVVKP IREPRVVVQT  420
VSEVDILDDG YRWRKYGQKV VRGNPNPRSY YKCTNAGCPV RKHVERASHD PKAVITTYEG  480
KHNHDVPTAR NNSHEMAGSA PVTGSSRVRA EENGSISLDL GVGIGYGMEN RSNGQLQTLP  540
AENVRNQVQV SSSSMMVVQP AAVAACYGIV NGGMSRFGPI DNRIQGTGFE SLPLQPSTQC  600
PQNYGRIILG P
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-149WRKY family protein