PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT27479
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 219aa    MW: 25084.5 Da    PI: 7.015
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT27479genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY91.37.5e-29133191159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYG+K+vk++++pr+YY+C+s gC+vkkkver+  d +++++tYeg+Hnhe
  OIT27479 133 LDDGYKWRKYGKKKVKSNTNPRNYYKCSSGGCKVKKKVERDGIDSSYLITTYEGKHNHE 191
               59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    
MFGSSTFQET TNISHQTINP NFAFSSLINM NQDHGHNMYQ DFDTSFLDNL INDGEEYSNS  60
NNSFNTSLYS QNPFMQQEIS TSTYSGNSSA SSFDATPTNI HMNENSSNKG IEKEKKAEKH  120
AIAFRTKTEL EILDDGYKWR KYGKKKVKSN TNPRNYYKCS SGGCKVKKKV ERDGIDSSYL  180
ITTYEGKHNH ESPFIIYCHE KPTVSFHNDQ WTLQADSLR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-14WRKY family protein