PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT27204
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 525aa    MW: 57311.9 Da    PI: 7.9078
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT27204genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.28.2e-34232288259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               dDgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d++v+ei+Y+g+Hnh+
  OIT27204 232 DDGYNWRKYGQKQVKGSEYPRSYYKCTHSNCPVKKKVERSL-DGQVTEIIYKGQHNHQ 288
               8****************************************.***************8 PP

2WRKY1079.5e-34411469159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+a+dpk+v++tYeg+Hnh+
  OIT27204 411 LDDGYRWRKYGQKVVKGNPYPRSYYKCTSQGCNVRKHVERAATDPKAVITTYEGKHNHD 469
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    
MADNEGSSSS SSTSRAQLLR PTITLPPRNS MESLFSVGLS GISPGPMTLV SSFFSDNDPD  60
SDCRSFSQLL AGAMSSPAGF SGVRPGFQPV PPPSTAATAQ EYKQNRPTGL VISQSPTTFT  120
VPPGLSPGGL FDGFFSPGQG PFGMSHQQVL AQFTTQAAQA QSQLHIRPDY PSSSTAAAAA  180
LSQFHSFASN AAANQQIPPP ALNPNIVKES SDVSLSDQRS EPASFAVDKP ADDGYNWRKY  240
GQKQVKGSEY PRSYYKCTHS NCPVKKKVER SLDGQVTEII YKGQHNHQPP QSSKRSKESG  300
NPNGNYNLQG SYEPSSEGLA GNFNKPKEGE TSYSLRMKDH ESSQATHDQI SGSSDSEEVG  360
DADTRVDGRD NDERESKRRA VEVQTSEAAC SHRTVTEPRI IVQTTSEVDL LDDGYRWRKY  420
GQKVVKGNPY PRSYYKCTSQ GCNVRKHVER AATDPKAVIT TYEGKHNHDV PAARNSSHNT  480
TNNSMSQLRP HNPVVDKPAA MRRTDFQNNE QQPIALLRFK EEQIT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-148WRKY family protein