PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT26818
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 301aa    MW: 33763.9 Da    PI: 7.0377
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT26818genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601383.4e-4371061100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++ +l  +k+e
  OIT26818   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEAEYRLRDPVYGCVGLISVLQHKLKQVQDDLLNAKKE 106
               7********************************************************************************************9888876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNATQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISVLQ HKLKQVQDDL LNAKKELATY IGPSAMLPIL  120
QHPGYIQQHP NNPSSSTMMP YNMQPMLGLP TGMQQQQQHG AQLMLRDPQQ QQQQNQQQVI  180
EAHQLAAAMA AREQQEMLRT YEQQPQQQQH PQFNSGFDSA GSPVTATGFH QMSSSVSPSL  240
ALGSFDNPYQ IQQTQQEHCG QVQVQPHQLL QQQQQLAQQP QTPQQQQRAK SEEERSIGPS  300
C
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-74LBD family protein