PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT25862
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 467aa    MW: 51898.9 Da    PI: 9.4413
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT25862genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.72.1e-32194250360
               -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               DgynWrKYGqK+vkgse+prsYY+Ct+ +Cpvkkkvers  d+++ ei+Y+geHnh+k
  OIT25862 194 DGYNWRKYGQKQVKGSEYPRSYYKCTHLKCPVKKKVERSF-DGQIAEIVYRGEHNHPK 250
               9***************************************.***************85 PP

2WRKY97.31e-30387442358
               -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
      WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
               Dg++WrKYGqK+vkgs +prsYYrCts++C+v+k ver+++dpk+++ tYeg+Hnh
  OIT25862 387 DGFRWRKYGQKVVKGSSYPRSYYRCTSPKCNVRKFVERTTDDPKAFINTYEGKHNH 442
               9******************************************************* PP

Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    
MEVNEGAKIA IARPVASRPR CLIYKSFSEL LAGAIDISST DVHSEMAITA IRPKTVRLKP  60
TTNNALVGDL SSQVGMSGAP VGSPSDNILQ LLEKPKVLYK PMAKLAPRKT IPLLENKGTS  120
ASDQQREVAD REAHVHSENE VKQQHDLTTE SQQSRLEKSG QDKKIVHSTI VSENTEEVEQ  180
SLINTSNVDR PSYDGYNWRK YGQKQVKGSE YPRSYYKCTH LKCPVKKKVE RSFDGQIAEI  240
VYRGEHNHPK PQPPKRNLSD GQGRAAVCND NTKETNKPAW SNQHPHTSEA YVCRMENQND  300
VGLSIHSAYS SKAPCFYDSI AAAGMHTAAL NSEDSAEGSK KLEATCDEPK SKRRKIEGQP  360
NEAGTSGESA FPYMPNQNTT DSEITGDGFR WRKYGQKVVK GSSYPRSYYR CTSPKCNVRK  420
FVERTTDDPK AFINTYEGKH NHGVPNRRPN SESSKTSSKS SAMKDKS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.15e-86WRKY family protein