PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT25165
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 283aa    MW: 30811.9 Da    PI: 10.1306
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT25165genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.94.6e-40591581100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               aCaaCk++rr+Ca+dC+lapyfpae++k+f n+hklFG+sn+lk+lk++p+ ++++am++l++eA++ra+dPv G+++vi++l++q++  +a+l+l+ ++
  OIT25165  59 ACAACKYQRRRCAPDCPLAPYFPAERQKDFLNAHKLFGVSNILKVLKNVPPFQKDNAMKALIFEANIRADDPVGGCHQVIQNLHRQINLYQAQLQLVYHQ 158
               7**********************************************************************************************99887 PP

Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    
MTNVVNNTQN ISSSPTPSAS ATTSAVTTST GIRSNPKNIT RVASRGGGSG GSGANGSQAC  60
AACKYQRRRC APDCPLAPYF PAERQKDFLN AHKLFGVSNI LKVLKNVPPF QKDNAMKALI  120
FEANIRADDP VGGCHQVIQN LHRQINLYQA QLQLVYHQIV RVQEAAIQEQ QNFNRMTSIR  180
GTNSNLNFDM LPLHGLQGFY RSNSICLGEA GSSSQIVKGK GVERFNNVEE FAAKTMMTHS  240
NGKQPLVESK DIKPYFGSIH NLKGKGVATE LSDETMVSKA RIN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-36LBD family protein