PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT21583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 148aa    MW: 16959.4 Da    PI: 7.6755
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT21583genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.55.3e-3951041100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk lrr+C++dC++ pyfp ++p++f +vh+++Gasnv k+l++++e++r d++++l+yeA +r++dPvyG+vg+i+ l++++ ql+ +la+lk+e
  OIT21583   5 RCAACKQLRRRCPSDCIFLPYFPPNNPQRFSCVHRIYGASNVGKMLQQVQEHQRADVADTLYYEAYCRIKDPVYGCVGIITVLHEEIYQLQCQLAKLKAE 104
               6***********************************************************************************************9987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    
MTSTRCAACK QLRRRCPSDC IFLPYFPPNN PQRFSCVHRI YGASNVGKML QQVQEHQRAD  60
VADTLYYEAY CRIKDPVYGC VGIITVLHEE IYQLQCQLAK LKAEIDLLKT QSPAQGQQVE  120
FSANLLADQN GVYTSSPSLF DPSFYWFY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-49LBD family protein