PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT20713
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 458aa    MW: 50874.9 Da    PI: 7.986
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT20713genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.93.2e-31220275359
               -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               DgynWrKYGqK+vk se+prsYY+Ct+ +Cpvkkkvers  d++++eitY+g+Hnhe
  OIT20713 220 DGYNWRKYGQKKVKASECPRSYYKCTHLKCPVKKKVERSV-DGHITEITYNGRHNHE 275
               9***************************************.***************7 PP

2WRKY102.23e-32389447159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYYrCt +gC+v+k+ver+++d k v++tYeg+Hnh+
  OIT20713 389 LDDGYKWRKYGQKVVKGNQHPRSYYRCTCPGCNVRKQVERASTDAKNVITTYEGKHNHD 447
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    
MSFPALTIPP RPSFESFFSN MPSFSPGPMS LVSSFFSDQS PDSSDYPSFS QLLAGAMTSP  60
LAKPALLPDN FGEGTQKNSG YKQNRPMGLV LAQSPLFMIP PGLSPSELLN SPGFLSPLQS  120
PFGMSHQQAL AHVTAQAAFS NSNMQMQAED QCSSQVASAE AFGHELTTEL KEASLQLKEP  180
SQTRMDSEPS DKQGKKFELL EFSQSENKPS FITVEKPACD GYNWRKYGQK KVKASECPRS  240
YYKCTHLKCP VKKKVERSVD GHITEITYNG RHNHELPQPS KQRKDGSALN GTDCSEVRPD  300
IQTHDWTVMN SSDGSSPSRS DQVPTQMASE LLVKREHDET KNILVAVDEG HDEPNAKRTK  360
TAVETLASSH STVAESKIVL QTRSEVDFLD DGYKWRKYGQ KVVKGNQHPR SYYRCTCPGC  420
NVRKQVERAS TDAKNVITTY EGKHNHDIPS VRNRNSQR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-119WRKY family protein