PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT20554
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 204aa    MW: 22219.3 Da    PI: 6.2327
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT20554genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.34.9e-42411401100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+++la++++e
  OIT20554  41 PCAACKILRRRCADKCVLAPYFPPNDPIKFTTAHRVFGASNIIKFLQELPEFQRADAVSSMVYEANARLRDPVYGCAGAICHLQKQVNELQVQLAKAQAE 140
               7***********************************************************************************************9987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    
MESSDTTAIT ITSPISSRSV SPSSASPPNS PPPPQVVIVS PCAACKILRR RCADKCVLAP  60
YFPPNDPIKF TTAHRVFGAS NIIKFLQELP EFQRADAVSS MVYEANARLR DPVYGCAGAI  120
CHLQKQVNEL QVQLAKAQAE IVNMQCEQAN LMALICMEIT QSPQASPQHY SLGNLTNITY  180
GSSQSNMTFL DDNSFGSFSE TLWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-67LBD family protein