PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT19278
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 243aa    MW: 25801.2 Da    PI: 5.316
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT19278genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260561.2e-174190150
    DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalp 50
              +CaaCk+l r+C ++Cvlapyfp ++p kf  +h++FGasn++k l+   
  OIT19278 41 PCAACKILCRRCIDKCVLAPYFPPTEPLKFTTAHRVFGASNIIKSLQVCT 90
              7*******************************************999765 PP

Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    
MDCINKTTII TTSQTLSSSS FSAGGSTAAP PSSPPVVPIT PCAACKILCR RCIDKCVLAP  60
YFPPTEPLKF TTAHRVFGAS NIIKSLQVCT QRSWKRPYGV GLLVGGLDES GAHLYYNCPS  120
GNYFEYQAFA IGSRSQAAKT YLERRYGSFT DSSRGSLLKD ALFALRETLQ GEKLTSTNCT  180
VAVLGIGEPF HMLDKDTIQG LINEFELAGE EAPAASTDAA ADAESAVPEA VAPTNEGAAP  240
MDI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-24LBD family protein