PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT08927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 84aa    MW: 9425.69 Da    PI: 8.3298
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT08927genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260112.33.4e-351484171
    DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearard 71
              +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rd
  OIT08927 14 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKIFGASNVTKLLNELQPHQREDAVNSLAYEADMRLRD 84
              7*******************************************************************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    
MASSSSSSLS SYSPCAACKF LRRKCQPECV FAPYFPPDQP QKFANVHKIF GASNVTKLLN  60
ELQPHQREDA VNSLAYEADM RLRD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.36e-48LBD family protein