PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT06607
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 350aa    MW: 39513.7 Da    PI: 6.8495
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT06607genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.66.3e-34193250259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +Dgy+WrKYGqK vk+s++prsYYrCts++Cpvkk+vers +dp++v++tYeg+Hnh+
  OIT06607 193 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCPVKKRVERSYQDPSIVITTYEGQHNHH 250
               8********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    
MADELRDFYY HQPFQEDIRL GYNNLYSQTR VGDSNDSSTV QNIHMLDPSF MSYTHEYLHG  60
SSSDYANSLG KPFGFSAPST PSDQAFSSII NKDHDVKPVL DVINNNDVIV GGGSETPVTP  120
NSSISNSSSN EAAGDDQDSN KNTNNTKKDK EVKESLEDGE DASKKENKAK KKEKTQRPQK  180
FAFMTKSEVD HLEDGYRWRK YGQKAVKNSP YPRSYYRCTS QKCPVKKRVE RSYQDPSIVI  240
TTYEGQHNHH LPSTLRGNVA RMLNPSMLSS PSPLMAAPQA FHQQLMNMAQ MPHQFYGSSG  300
FGINPPTNSS SNMYNQNVIT QHELHQQLQF SPDYGLLQDM VPSMFLKQEP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.13e-55WRKY family protein