PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT06532
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 347aa    MW: 38969.6 Da    PI: 6.1872
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT06532genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.4e-32185242259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +Dgy+WrKYGqK+vk+s fpr+YYrCtsa+C+vkk+ver+ +dp++v++tYeg+H+h+
  OIT06532 185 EDGYRWRKYGQKTVKNSSFPRNYYRCTSASCNVKKRVERCFNDPSIVVTTYEGKHTHP 242
               8********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    
MESYKEIAIK MEDPMSYFDN FPVISNSFTG LVSDYNYAVE GKNTSIDSSL GFMELLGVQD  60
FCSASVFDVN STTTNHDQLL PKEEKYHIEP AVSISEEVKP SPAAESQNKA AHESSSNILN  120
TPSTPNSSSI SSETNEGHAQ DAEGEVAEEQ TKTKQQLKAK KTVSQKKEKE PRIAFMTKSE  180
VDFLEDGYRW RKYGQKTVKN SSFPRNYYRC TSASCNVKKR VERCFNDPSI VVTTYEGKHT  240
HPSPMNMNMN MNMNMINMPR PTLFPTRVFP SPAPTATFPL QMPFHINQSA QPHFNDLTTP  300
LASNLDHAAL VAHGRRFCSA PSAAEMMRDQ GLLQDLMSSR VVEEDYR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.11e-42WRKY family protein