PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT05082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 199aa    MW: 22336.3 Da    PI: 4.7622
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT05082genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26074.71.7e-2357431100
    DUF260  31 anvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               a++hk+FGasnv+kll+++p ++r +a+ +++yeA+ar++dP+yG+v++i++lqqq+ +l+a+la+lke+
  OIT05082   5 AAIHKVFGASNVSKLLAHIPVTDRGEAAVTIAYEAQARLQDPIYGCVSHIFALQQQVVNLQAQLASLKEQ 74 
               579**************************************************************99987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    
MTGSAAIHKV FGASNVSKLL AHIPVTDRGE AAVTIAYEAQ ARLQDPIYGC VSHIFALQQQ  60
VVNLQAQLAS LKEQAAHQNL QNGSNYANPN YEKFQDLQSW FHQSENSNTN MSQFDSSLTS  120
NNIGSTPYYG SHENMTSNNY HMGSYENMML TKENMSSFEE GSCSIDSYDM QTDHHNSQWT  180
FQDDADDLQS VAFRYLQHS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58190.18e-29LBD family protein