PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT03865
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 189aa    MW: 20866.8 Da    PI: 4.7582
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT03865genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.64.5e-4333131199
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
               +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da++s+vyeA+ar+rdPvyG++g i +lq+q+++l+aela+++ 
  OIT03865  33 PCAACKILRRRCVDKCVLAPYFPPTEPLKFTIAHRVFGASNIIKMLQELPEDQRADAVNSMVYEANARIRDPVYGCAGAICQLQKQISELQAELAKAQV 131
               7**********************************************************************************************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    
MECSDKTSGT SSSSSAGMMT PPPSPPWPVI LTPCAACKIL RRRCVDKCVL APYFPPTEPL  60
KFTIAHRVFG ASNIIKMLQE LPEDQRADAV NSMVYEANAR IRDPVYGCAG AICQLQKQIS  120
ELQAELAKAQ VEMLNVQCQN TNLVSLICRE MSQNQENNGS VCPDQQTYGN TSLFLDDNSV  180
YASWEPLWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-74LBD family protein