PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT03828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 166aa    MW: 18252.7 Da    PI: 7.8022
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT03828genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.12e-45111101100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +Ca+Ck+lrr+C +dCv+apyfpa++p+kfanvhk+FGasnv+k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la++++e
  OIT03828  11 PCAGCKLLRRRCGEDCVFAPYFPADEPHKFANVHKVFGASNVSKMLQELPEHKRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDMLRTQLAMAQAE 110
               7**********************************************************************************************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    
MKDCGKNSNS PCAGCKLLRR RCGEDCVFAP YFPADEPHKF ANVHKVFGAS NVSKMLQELP  60
EHKRGDAVSS MVYEANARVR DPVYGCVGAI SSLQQQIDML RTQLAMAQAE VVHLRLRQSA  120
GITTSPTNSG SPSSHIMGSH QPKGYFHMDL DVDQSNNGFN EPIWPC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-64LBD family protein