PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT03663
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 174aa    MW: 19442.9 Da    PI: 6.7461
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT03663genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.41.8e-41111101100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+l+r+C+++C +apyf +++pkkfanvhk+FGasnv+k+l+++p+++red++++lvyeAe+r+rdPvyG++g i +lq+++ +l+++l +++++
  OIT03663  11 SCAACKFLKRRCTSNCQFAPYFRSDEPKKFANVHKVFGASNVIKILNEVPQDQREDTVNTLVYEAEVRLRDPVYGCIGAIASLQRKMVELQHDLMVTRAH 110
               6********************************************************************************************9998876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    
MKNNESRSSS SCAACKFLKR RCTSNCQFAP YFRSDEPKKF ANVHKVFGAS NVIKILNEVP  60
QDQREDTVNT LVYEAEVRLR DPVYGCIGAI ASLQRKMVEL QHDLMVTRAH LAYYEAKPST  120
SCSFLDYDPL NVVVPSVFVD TSLSGGFLDN FSQNSFGMDN STGSTNELGQ FPFP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.12e-59LBD family protein