PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT03302
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 497aa    MW: 55377.8 Da    PI: 7.7083
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT03302genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.35e-3180137260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               dDg++WrKYGqK vkgs+fprsYY+Ct+++Cpv+kkve++  +++v+ei+Y+g Hnh+k
  OIT03302  80 DDGFTWRKYGQKRVKGSNFPRSYYKCTQQSCPVRKKVECAP-NGQVIEIVYNGAHNHPK 137
               8****************************************.***************85 PP

2WRKY102.52.3e-32288345259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +Dgy+WrKYGqK+vkg+++prsYY+Ct agC v+k+ver++++ k v++tYeg+Hnhe
  OIT03302 288 EDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCIVRKHVERASDNLKSVITTYEGKHNHE 345
               8********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    
MSSPPCRPAV LTIPPGISPA ALLDSPVTFP NSVAPTETNV QQTLNNIELT NKQISQQEEF  60
TKKENQFGFF SSSISPSSSD DGFTWRKYGQ KRVKGSNFPR SYYKCTQQSC PVRKKVECAP  120
NGQVIEIVYN GAHNHPKTQS IQRPSMDNSF VVRDVEEIGQ ENASVWRYQQ FECNKNVTSY  180
NANGLKRTSS ASVLTEVSDP MSTNPKSMNV FESAGTPELS STLTSYDGDD GDWATQEGTF  240
LGDDVNEYEL EPKRRKKESY SAEPSLLSRT VREPKVVLQV ESEIDILEDG YRWRKYGQKV  300
VKGNPNPRSY YKCTNAGCIV RKHVERASDN LKSVITTYEG KHNHEVPSTN KTNGVPGHIQ  360
SASTLNGQTN CMTSRKGPKG SNCRVQVQDL PFPFERKPFV GSEYLRPSFV GSYLGDLSFG  420
ACSLQLPNFP LPLPLPSRMS FPARLNEPPL DDFHLSNHHL LPNGASNSFL AVGNMQHIND  480
DNNNSSLLKA KEEIQWT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1252258PKRRKKE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-70WRKY family protein