PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT02130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 226aa    MW: 25794 Da    PI: 8.9005
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT02130genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.52.4e-32149207159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  OIT02130 149 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 207
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    
MFSQSLFEDE ADMSSQLGFF TFPPNNNNMG SAITTSLPFG ICNHKTLTII PPSFAAHNNS  60
LIESTSLRQK EDLTTSIFGG PHLLSLQKSS ANTWAWGEVN ESNNIKRSRD NIDDHLGVSA  120
IKMKKMKSST RKVREPRFCF KTLSDVDVLD DGYKWRKYGQ KVVKNTQHPR SYYRCTQDNC  180
RVKKRVERLA EDPRMVITTY EGRHVHSPSL DEDDSQASSQ LNNLLW
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.12e-58WRKY family protein