PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT01281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 563aa    MW: 62747.6 Da    PI: 8.3177
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT01281genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.23.5e-33228285260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkver+  d++++ei+Y+g+Hnh+k
  OIT01281 228 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERNL-DGHITEIVYKGNHNHPK 285
               8****************************************.***************85 PP

2WRKY1062e-33392450159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  OIT01281 392 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFTGCPVRKHVERASHDLRAVITTYEGKHNHD 450
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    
MASSGGNMNT FMNSFTSNYS FSSFSDLLSD NNNNNNNNNN MRSNNSSMNQ EKNSLNWGFS  60
DQRMNQQNKD EVPKFKSFPP CSLPMISSSS PASPSSYLAF PPSLSPSVLL DSPVLFNNSN  120
TLPSPTTGSF GNLNSKEDNS KISDFSFQSR AATSSSMFQS SAPRNSLEDL MTRQQHANQQ  180
NEFSTAKTTG VKSEVAQIQS FSQEKMQSYP APVHYTQPSQ YVREQKAEDG YNWRKYGQKQ  240
VKGSENPRSY YKCTFPNCPT KKKVERNLDG HITEIVYKGN HNHPKPQSTR RSSSQSIQNL  300
AYSNLDITNQ PNAFLDNAQR DSFAGTDNSS ASFGDEDVDQ GSPISKSGED DGNEPEAKRW  360
KCDNENEVIS SASRTVREPR IVVQTTSDID ILDDGYRWRK YGQKVVKGNP NPRSYYKCTF  420
TGCPVRKHVE RASHDLRAVI TTYEGKHNHD VPAARGSGSY AMNKPPSGNS NNSMPVVPRP  480
SMLANNSNQG MNFNDTFFNT RVQTTQNQPP ITLQMLQSSG SSSYSGFDTS SGSYMDQMQP  540
MNNTKPISKE EPKDDLFFSS FLN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-119WRKY family protein