PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT01223
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 205aa    MW: 23237.3 Da    PI: 8.813
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT01223genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.62.4e-3411105195
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
               aCa+Ck++r+kCa+ C+lapyfpa+++++f++vhk+FG+snv+kl+kal+ee+r++a++slv+ A +r+rdPv G++g ++++ ++l+  k++ +
  OIT01223  11 ACASCKYQRKKCADTCILAPYFPAAKNREFQAVHKIFGVSNVTKLIKALNEEDRKKAADSLVWDAFCRQRDPVLGSYGEYRRVVEELKLYKSQYQ 105
               7***********************************************************************************99999988766 PP

Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    
MQKINSRDTA ACASCKYQRK KCADTCILAP YFPAAKNREF QAVHKIFGVS NVTKLIKALN  60
EEDRKKAADS LVWDAFCRQR DPVLGSYGEY RRVVEELKLY KSQYQQILQM PSQGATGLMY  120
NAAQGLNNGY NNRANSIMES WPCSNNIHLQ YVQNMEKLRS DSNGSTIIVP QQAIDGFTNH  180
YYLTAGNCNP IDVKRMENSL WEASS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.19e-48LBD family protein