PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT00876
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 551aa    MW: 61249.7 Da    PI: 7.9146
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT00876genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.91e-33228285260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  OIT00876 228 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITEIVYKGNHNHPK 285
               7****************************************.***************85 PP

2WRKY106.61.3e-33395453159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYY+Cts+gCpv+k+ver+++d + v++tYeg+Hnh+
  OIT00876 395 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSPGCPVRKHVERASQDIRSVITTYEGKHNHD 453
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    
MAASSTIIDT SSMQNSSFSF PTSSSSSSSS FMTSSFTDLL ASDDYPTKSK GLGDRIAERT  60
GSGVPKFKSF PPPSLPLSPP PFSPSSYFAI PPGLSPTELL DSPVLLSASN ILPSPTTGTF  120
PAQAFNWKSS RHQGVKQEDK NYSDFSFQPQ FGQSFASVSP SQTNPVPLGN QSWNYQESRK  180
QNDQSSENAN GRTEFNTMQS LKNNAQSNGG NQYNNQSSQS IREQKRSEDG YNWRKYGQKQ  240
VKGSENPRSY YKCTFPNCPT KKKVERSLDG QITEIVYKGN HNHPKPQSTR RSSSTASSSS  300
AVQPYNTQTN EIPDHQSYGS NATPENSSIS FGDDDHEHSS QKSRSRGDDF DEEEEEPDSK  360
RWKRESESES LSAPGSRTVR EPRVVVQTTS DIDILDDGYR WRKYGQKVVK GNPNPRSYYK  420
CTSPGCPVRK HVERASQDIR SVITTYEGKH NHDVPAARGS GINRPVAPSI TYNNGANAVR  480
PFVTSQIPLQ SIRPHQSPFT LEMLQKPSNY NGFSGYANSE DSYENQLQDN NVFSRAKDEP  540
RDDMFMDTLL C
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-104WRKY family protein