PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT00756
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 527aa    MW: 58369 Da    PI: 7.0523
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT00756genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.29.4e-30245302260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               +DgynWrKYGqK v+g+ef+rsYY+Cts++C +kk+vers+ d+++++i+Y  +H+h+k
  OIT00756 245 EDGYNWRKYGQKLVRGNEFTRSYYKCTSPNCLAKKQVERSH-DGHITNIHYIAKHEHPK 302
               7****************************************.***************85 PP

2WRKY104.94.3e-33422480159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ++Dgy+WrKYGqK vkg+++prsYYrC+sagCp+kk+ver+++dpk+v++ Yeg+H+h+
  OIT00756 422 VNDGYRWRKYGQKLVKGNPNPRSYYRCSSAGCPAKKHVERASHDPKLVVTAYEGQHDHD 480
               58********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    
MGTHKEDVTD EVSSEKLQQK QDLDTVTYRS ELKEKGICES MSAEVISGEL QKRVSPDALE  60
KSSQSNQDEN ALSTTCQEVS GEVKPKKSVI EGIEKFQQKP DPDTVTNRSE SKEKGTCDSV  120
SAKVVSDELL KGLSPDSLAK ASESSRVSVL PKKEPYIKSC ESDPPVKDRN VSLVPGKASD  180
SSQNIQREKM EVVVSQPNQE QVTYSTRPEK ALDKLQPRRN LDMNVQALPS DQEIIPFRSP  240
EKPSEDGYNW RKYGQKLVRG NEFTRSYYKC TSPNCLAKKQ VERSHDGHIT NIHYIAKHEH  300
PKPLNSPQIS PEFVVPMQMK QTDMPMGTPR EAEGKKSIVI GQTCQSIEPS ESSLSTAIVP  360
AGDSATDTVM KPHKSGDEAD NSGGPDPKRQ KREVPRSDEI PPIKSHSEPQ HIVQTRSEVD  420
IVNDGYRWRK YGQKLVKGNP NPRSYYRCSS AGCPAKKHVE RASHDPKLVV TAYEGQHDHD  480
IPPSRTVMQN AAGADSNNTT RISGESTPES GENKHVGLDR VVHIGAN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.21e-75WRKY family protein