PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT00595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 731aa    MW: 79607.4 Da    PI: 6.4066
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT00595genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.89.7e-33314371260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers+ +++++ei+Y+g Hnh+k
  OIT00595 314 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSH-EGHITEIIYKGAHNHPK 371
               8****************************************.***************85 PP

2WRKY104.17.4e-33528586159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  OIT00595 528 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCNVRKHVERASHDLKSVITTYEGKHNHD 586
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    
MGGFDDHVAI MGDWMPPSPS PRTFFSSLLG DDIGSRSTFE FPNENKRGNL ASEPQEHVGN  60
SDGAQTDATT VKSDQKMSSR GGLLERMAAR AGFNAPKLNT ESLRPADLSQ DQGVRSPYLT  120
IPPGLSPTSL LESPVFLSNS LVQPSPTTGK FQFASGIESR NSTFMMEDPD KRKENALESI  180
NSSSFSFKPV PETAPSLFPG ATSRSWLQVN SSNISQQCFP NNKVSVHSQN SLLSHCMEAT  240
QMQTQNEKGL HQSSDFPRFS AEKDVRDSNV TPDSTNFQTV GSNVEHSPPL DEPQDEEIDQ  300
RVGGDPNVVG APAEDGYNWR KYGQKQVKGS EYPRSYYKCT HPNCPVKKKV ERSHEGHITE  360
IIYKGAHNHP KPLPNRRSTL GSTNSLGELQ LDGAEQGVSG SNGDLGRANI QKASDAGGLD  420
WRNNNLDVTS SAHLGSAYCN GSASFPVQNN TQLESGGAVD VSSTFSNDED EDDRGTHGSV  480
SQGYDGEGDE SESKRRKLET YSTDMSGATR AIREPRVVVQ TTSEVDILDD GYRWRKYGQK  540
VVKGNPNPRS YYKCTSAGCN VRKHVERASH DLKSVITTYE GKHNHDVPAA RNSSHVNSGA  600
SNTLPAPVTA PPAQSHLHRP EPAQLQNAMA RFDRQPSLGS FGPTPGFSYG MNQQSLASLA  660
MAGFHPNQSK SQQQVPVHSY LGQPRPMHDG GFMFPKEEPK AEPMSDPGLD LSNGSSIYQQ  720
FMSRLPLGPQ M
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-177WRKY family protein