PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT00233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 298aa    MW: 33340.9 Da    PI: 6.164
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT00233genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.11.8e-33162219259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +Dgy+WrKYGqK vk+s+fprsYYrCts++C+vkk+vers edp+vv++tYeg+Hnh+
  OIT00233 162 EDGYRWRKYGQKAVKNSPFPRSYYRCTSQKCSVKKRVERSYEDPSVVITTYEGQHNHH 219
               8********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    
MSDNNPFYHD YMGTGGVNNA FSFFGDQNPS IYDQIPTNTQ TPHQDFDPSS YMSTLTECLH  60
GSMDYNSLSN VLCSSSEVVC PPLDQGAEIP LTPNSLVSSS SSEAGGEEDS SKSKKDLQGK  120
DQCEDGDDDK SKKVSKAKKK GEKKQKEPRF AFMTKSEIDN LEDGYRWRKY GQKAVKNSPF  180
PRSYYRCTSQ KCSVKKRVER SYEDPSVVIT TYEGQHNHHC PATLRGNAAA AMLSPSFLSS  240
SQLIPQDVLF AQMLTTPTNQ NQLPINYSVY NYQQQPQLGP EYGLFQDMVA SLIHKREP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.18e-52WRKY family protein