PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIS99505
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 207aa    MW: 22661.8 Da    PI: 5.2973
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIS99505genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.64.5e-43541531100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpee+r+da++s+vyeA+ar+rdPvyG++gvi + q+q+++l+ae a++++e
  OIS99505  54 PCAACKILRRRCVDKCVLAPYFPPTDPLKFTIAHRVFGASNIIKMLQELPEEQRTDAVNSMVYEANARIRDPVYGCAGVICQFQKQISELQAEFAKAQAE 153
               7***********************************************************************************************9987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    
MECSDNKTTI SSLSAGSMKS PNNVSATTKS SGLISPRSIL SAPPSPPSPV ILTPCAACKI  60
LRRRCVDKCV LAPYFPPTDP LKFTIAHRVF GASNIIKMLQ ELPEEQRTDA VNSMVYEANA  120
RIRDPVYGCA GVICQFQKQI SELQAEFAKA QAEILNLKCQ NSNLLALVCM EVSEYQENSS  180
SSNDYGNNTS LFLEDNSVYA AWEPLWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-73LBD family protein