PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIS97366
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 231aa    MW: 25067.5 Da    PI: 8.7169
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIS97366genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.63.3e-41501491100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++p  +r da++slvyeA++r+rdPvyG++g i++lqqql++l+ael+++++e
  OIS97366  50 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLLEVPVGQRADAANSLVYEANVRLRDPVYGCMGAISTLQQQLQTLQAELNAIRSE 149
               7**********************************************************************************************99887 PP

Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    
MSRERERLDE IGKKLKTEID ASSQLHMQQQ MGRRQILGPT VGTTLNTITP CAACKLLRRR  60
CAEECPFSPY FSPHEPQKFA AVHKVFGASN VSKLLLEVPV GQRADAANSL VYEANVRLRD  120
PVYGCMGAIS TLQQQLQTLQ AELNAIRSEI LRYKYREAAN SLIASISTSV ADQLPQAPPT  180
PPPPPPPLPS VVVVSSSSST SSVSSLYTPP SSAGANFSAA IHNNSISYFD Q
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-78LBD family protein