PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIS96539
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 213aa    MW: 23305.4 Da    PI: 6.4769
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIS96539genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.21.2e-42461451100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la++++e
  OIS96539  46 PCAACKILRRRCADKCVLAPYFPPNDPIKFTTAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARLRDPVYGCAGAICQLQKQVNELQAQLAKAQAE 145
               7**********************************************************************************************99976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    
MEYSSETKAT VISTSPSSSR SVSPPSSSSS SPNSPPPPPP MVVVSPCAAC KILRRRCADK  60
CVLAPYFPPN DPIKFTTAHR VFGASNIIKF LQELPESQRA DAVSSMVYEA NARLRDPVYG  120
CAGAICQLQK QVNELQAQLA KAQAEVVNMQ CQQANLMALI CMDMNQSSPQ ASPQQQSNLE  180
SFTNNIPHSF QNNMSFLDDN NNFGSVWEPL MWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-62LBD family protein