PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RDX86631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Phaseoleae; Mucuna
Family SAP
Protein Properties Length: 467aa    MW: 51491.2 Da    PI: 8.2391
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RDX86631.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP690.91.6e-21014651455
         SAP   1 mssssssssseseegseggeggdass..........gesegpsssrqraanevwpePflealatqvaidasrslGrlaaasalanvfqvcstwravsrs 89 
                 mss+ssssss+ ++  e     ++++          g++eg+sssrqra+ne++pePfleala+q a+da++++Grlaaasala++fqvcstwr+vsrs
  RDX86631.1   1 MSSTSSSSSSSTSSPYEPAGHVGQGAdipgpstrrtGQFEGSSSSRQRAMNELLPEPFLEALAIQHALDAAHYNGRLAAASALAILFQVCSTWREVSRS 99 
                 77777766665554443333334444678899******************************************************************* PP

         SAP  90 dllwqrltrriWrrtkllrdtWreeyiyrhrtarnfrtrrysyvtlqfdpadvdedndadalsCrclalsdkylaaGfadGavrlfdletrlhvstflp 188
                 d lwq+lt riWrr+++lr+tWr eyiy+hrtarnf t+r+s   ++fdp+   ++++  +l+Crc+alsd++la+Gf+dG+vrlfdletr+hvst+++
  RDX86631.1 100 DPLWQHLTTRIWRRAYRLRATWRLEYIYWHRTARNFATGRHSI-IPHFDPS---DHHHHPNLICRCVALSDTHLACGFIDGTVRLFDLETRVHVSTYVS 194
                 *****************************************96.589***8...4456689************************************** PP

         SAP 189 qhrdrlGrfsravsGivisdsrlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaGsgrWwvGlyaGvpGrafhiWdaeteelvfvGGslt 287
                 ++++++G+fsr++sGivi +s +vfa+ldGd++v+ i+g+g ++arra+ Gdvvn+G+lv faGsg WwvGlyaG++Graf+iW    ee+vfvGGslt
  RDX86631.1 195 ENGQLFGPFSRSISGIVIDNSLIVFARLDGDVYVDFINGPGPSHARRAVSGDVVNNGVLVGFAGSGLWWVGLYAGIAGRAFQIWY--REERVFVGGSLT 291
                 ************************************************************************************6..69********** PP

         SAP 288 dPeavmGWhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeerrGlivssldasneayvvvdsrGvatvrrvenleevcrfrvrg.a 385
                 dPe+v+GWhmltel+e vGrvrvte e +vaCt +rlv+f lrn++v lr++ +++G++vssldas ea+vvv+++Gv+tvrr++++++++rfr+rg +
  RDX86631.1 292 DPETVRGWHMLTELVEPVGRVRVTEPELVVACTGSRLVCFALRNPEVWLRDVGSTSGFVVSSLDASPEAFVVVERSGVGTVRRASTFQRLSRFRLRGsW 390
                 *************************************************************************************************** PP

         SAP 386 qrgvlgCvnggyalvyagg....vlrvWeiekkeg.ylyslrervgevnalvaddrhvavsssdgtihlldfgaq 455
                  rg++gC+n gy+l+y+++     lrvW+ie  +g ++++l +r ge n++va++rhva+s +d++i+lldfgaq
  RDX86631.1 391 VRGLWGCMNMGYVLTYSSSapasSLRVWDIEPPVGrLCVTLGVRSGEGNSMVANERHVAISWNDSMINLLDFGAQ 465
                 ****************99888889********9998*************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    
MSSTSSSSSS STSSPYEPAG HVGQGADIPG PSTRRTGQFE GSSSSRQRAM NELLPEPFLE  60
ALAIQHALDA AHYNGRLAAA SALAILFQVC STWREVSRSD PLWQHLTTRI WRRAYRLRAT  120
WRLEYIYWHR TARNFATGRH SIIPHFDPSD HHHHPNLICR CVALSDTHLA CGFIDGTVRL  180
FDLETRVHVS TYVSENGQLF GPFSRSISGI VIDNSLIVFA RLDGDVYVDF INGPGPSHAR  240
RAVSGDVVNN GVLVGFAGSG LWWVGLYAGI AGRAFQIWYR EERVFVGGSL TDPETVRGWH  300
MLTELVEPVG RVRVTEPELV VACTGSRLVC FALRNPEVWL RDVGSTSGFV VSSLDASPEA  360
FVVVERSGVG TVRRASTFQR LSRFRLRGSW VRGLWGCMNM GYVLTYSSSA PASSLRVWDI  420
EPPVGRLCVT LGVRSGEGNS MVANERHVAI SWNDSMINLL DFGAQNP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.11e-104SAP family protein