PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0048s0366.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family DBB
Protein Properties Length: 268aa    MW: 29829.1 Da    PI: 4.0516
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0048s0366.2.pgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.41.2e-07434535
             zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHk 35
                         kC+ +++++   +C++++ +lC dC ++ H 
  Kaladp0048s0366.2.p  4 KCDFCGNQRSVVYCRSDDACLCLDCDTSVHT 34
                         7***************************994 PP

2zf-B_box24.84.4e-084789541
             zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvp 41
                         +C++++++++ l C + ++ lC++C  ++H g       H++++
  Kaladp0048s0366.2.p 47 VCQRCNSQPAVLQCIEERVSLCQSCDWAGH-GastsaaaHKRRN 89
                         8*****************************.5588888898765 PP

Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    
MGYKCDFCGN QRSVVYCRSD DACLCLDCDT SVHTANSLSR RHWRTLVCQR CNSQPAVLQC  60
IEERVSLCQS CDWAGHGAST SAAAHKRRNI KFYSDCPSAA ELQAIWSFEL EGFLGSVSIG  120
EQEMGLLSIT EKNVKQSEPL STEVNQLCNI NPDEVWNSSA QDMDSLFPDE RLETEVANSP  180
QPMVSFSGAI NPTEDDDLFA NFGMDESELN LENYEELFRV NLSQSEELLE NGGIDSLFEP  240
TNKSLSELDC RETLVSQVYF SPLLVLQ*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.25e-58CO-like family protein