PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0016s0089.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family DBB
Protein Properties Length: 286aa    MW: 30906.9 Da    PI: 6.4166
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0016s0089.1.pgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box193e-06434535
             zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHk 35
                          C+ +++  ++ +C  ++  lC++C    H+
  Kaladp0016s0089.1.p  4 QCDVCNKDGASVYCPADEAALCASCDYGVHH 34
                         7******99*****************99974 PP

2zf-B_box284.4e-095697438
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Ht 38
                         ++C+ +++k++ lfC++++  lC dC  ++H         H+
  Kaladp0016s0089.1.p 56 PNCDICQDKRAFLFCKQDRAILCSDCDASIHAAnqltqrhHR 97
                         79*****************************65667777555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    
MKIQCDVCNK DGASVYCPAD EAALCASCDY GVHHANKLAS SHYRFNLLTP SAKDTPNCDI  60
CQDKRAFLFC KQDRAILCSD CDASIHAANQ LTQRHHRFLL TGVKLSAKTN LYAAAGSDPI  120
PDFESHPSAA KKNLAASQPA AHKTCSCCDQ LMGDPCSTSS ISEYLMETLP GWRVDDLLDS  180
SSAPYAFSKQ YDDGLLLPFM DADVLGHSDL MGSLFPESWA SQVPSISPPF PQVPHYPSSY  240
APVACKETTS MKATDSRKSL IDDGFTVPQM ISPHSSVGTK RSRLV*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.14e-71DBB family protein