PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019200236.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 362aa    MW: 41240.3 Da    PI: 6.0558
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019200236.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like69.64.9e-22187238254
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                     p+ +Wt+eLH++F++av+qL G+ +  Pk+i e+mkv+gLt+e+v+SHLQ+ R
  XP_019200236.1 187 PKFKWTEELHAKFLDAVNQL-GAGNCFPKEIWEMMKVPGLTREKVASHLQRCR 238
                     789*****************.999**************************988 PP

2Myb_DNA-binding377.7e-12190237347
                      SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHT.TTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGgg..tWktIartmg.kgRtlkqcksrwqky 47 
                      +WT+e++ +++dav+qlG g   +k I ++m   g+t++ + s++q  
   XP_019200236.1 190 KWTEELHAKFLDAVNQLGAGncFPKEIWEMMKvPGLTREKVASHLQRC 237
                      7********************************************975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    
MGEIGGFCHS FPQVVTDDFQ PPRLMHDVHV LLVEHRVNFV VNAKELGTSM IAEILKQFSY  60
EVTVVESASC ALSRLYNGTE KFDVLMVNFY LPEISDEEDE NGDEVARSAI EQGVFLYLEK  120
PFPVDMLKYL WQHVYRERRL MNHSSQALDI SMVAETLING ENNIVFTDNQ TATDSNNINH  180
LPRRRGPKFK WTEELHAKFL DAVNQLGAGN CFPKEIWEMM KVPGLTREKV ASHLQRCRDN  240
KWRPLEEHRN RRRSRTMQFS SQPRRPRGQK FGFMPSVEET NNNGNIPPQE KNIAAANDGT  300
SSQNGDHNNE FDSSLTMSTN SVTNTDVGIL QTVQISEGTI HDRSLCCEFV ANPLAGHRRG  360
DV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.16e-23ARR-B family protein