PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019200162.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 121aa    MW: 13982 Da    PI: 4.6144
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019200162.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like703.7e-22152455
         G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    + Wt eLH++F++av +LGG++ A+ ++ilelm+v+gLt ++v SHLQk R+
  XP_019200162.1  1 MFWTFELHSQFMDAVIELGGIKDAVSSQILELMDVPGLTWKNVNSHLQKIRI 52
                    57***********************************************996 PP

2Myb_DNA-binding249e-08350447
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqky 47
                     WT e++ ++ dav +lGg      + I + m   g+t k++ s++qk 
   XP_019200162.1  3 WTFELHSQFMDAVIELGGIkdaVSSQILELMDvPGLTWKNVNSHLQKI 50
                     *****************8899999999999999999999999999996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    
MFWTFELHSQ FMDAVIELGG IKDAVSSQIL ELMDVPGLTW KNVNSHLQKI RILQVRGPER  60
MNKNAIFHQQ YLLTTTGGAR IFQDWSRFLS ACSSFRNDDD IMNDIYGSLS PLWDLPMLED  120
D
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.22e-14ARR-B family protein