PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019197003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 467aa    MW: 51551.6 Da    PI: 5.2465
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019197003.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32254308155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr+rWtpeLHe+F+eav++L G+ekAtPk++l+lm+v+gLt++hvkSHLQkYRl
  XP_019197003.1 254 KPRMRWTPELHESFMEAVKKLDGAEKATPKAVLKLMNVEGLTIYHVKSHLQKYRL 308
                     79****************************************************8 PP

2Myb_DNA-binding52.31.3e-16256307148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT+e++e + +avk+l g    t+k++ + m+ +g+t +++ks++qky+
   XP_019197003.1 256 RMRWTPELHESFMEAVKKLDGAekaTPKAVLKLMNvEGLTIYHVKSHLQKYR 307
                      89******************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    
MKNYMFLPGR HPELEDEVSE SYCTTVSDIH NVSSGEQHLL ADDCSSGSVP HNLSSDFLHK  60
CTEKSPIVSP TPNQCSSFSS ASHVQQPQNQ FSRSSMFCTS LHLSSSSSLE TTLRLGSLPF  120
LPDPSPHRLP NNFTIQSSDS PLHVQSDEGP SEASLKILQN ILLDEPDGSV KHGHCEINDL  180
QLTEQMELQL LSDELDIAIG GDVENPRIDE IYEEPQALIQ QSRESTPSQN FLSCTLPTDK  240
LSVPPSAVPA ASHKPRMRWT PELHESFMEA VKKLDGAEKA TPKAVLKLMN VEGLTIYHVK  300
SHLQKYRLAK YMPERTEEKK TSSSEDKKAT VNGKGSEGRK KGNIQVMEAL RMQMEVQKQL  360
HEQLEVQRAL QVRIEEHARY LQKILEEQQK GGCSVPAPPQ TGSCADSEPR LASSPTSVSP  420
SCDDVASSKL EAEDGGGILE HETPHKRPRT ANSESSSVEV LDESCKN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.12e-79G2-like family protein