PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019190662.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 330aa    MW: 37636.5 Da    PI: 9.9241
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019190662.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.8e-32198251255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rF++ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_019190662.1 198 PRMRWTSTLHARFIHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 251
                     9****************************************************7 PP

2Myb_DNA-binding46.58.5e-15199250148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT  ++ ++++av++lGg+   t+k++ + m  k +tl ++ks++q+y+
   XP_019190662.1 199 RMRWTSTLHARFIHAVELLGGHeraTPKSVLELMDvKDLTLAHVKSHLQMYR 250
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    
MELFPAQPDL SLQISPPTTK QQKITEDSNH HEMDLGFWKR ALDTKNHSIQ SFSSNKPSCN  60
FDLSLSNHPT HSSSPPSNNT NIFHYHPPNT IHQNNLYSHH HHHHLFQHHQ QQQQQQTGPD  120
FGFLRPIRGI PVYYQTPSSN SPHPFPFPHI PFDNNSVTAT SSSSGAHQHH HHQTSAGLMR  180
SRFLSSSRFP AKRSMRAPRM RWTSTLHARF IHAVELLGGH ERATPKSVLE LMDVKDLTLA  240
HVKSHLQMYR TVKTTDKAAA ATSGQSEVFD NGSSGETSED LTLDIRTSRK SDEFSVQQRR  300
TNIHSNQDNI DNYHHALWSN SSRKTWKQSV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-44G2-like family protein