PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019182597.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 318aa    MW: 35263 Da    PI: 6.6363
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019182597.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.4e-32186241156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rFv+a+++LGG++ AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  XP_019182597.1 186 KQRRCWSPELHQRFVNALDKLGGAQAATPKQIREIMNVDGLTNDEVKSHLQKYRLH 241
                     79****************************************************97 PP

2Myb_DNA-binding431.1e-13188239148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r  W++e+++++v+a  +lGg    t+k I + m+  g+t  ++ks++qky+
   XP_019182597.1 188 RRCWSPELHQRFVNALDKLGGAqaaTPKQIREIMNvDGLTNDEVKSHLQKYR 239
                      568*****************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    
MAQNFGERNI DLNCEFVVPK SVSIALAEIS AIDDDSQKLL KLYSLLQALE EEAKKIYLNR  60
RELPYTLSLL TDEIEKVRGE CLKVKGKEKL PAVVEELLPM KDNFDKEIGT KRSNDQGDTK  120
NWMISALWNH PGGVNGEEED ALKRDALPVP CLSLSPPSVP PSVVAYKSSS SRSHSSKTMN  180
KQEQRKQRRC WSPELHQRFV NALDKLGGAQ AATPKQIREI MNVDGLTNDE VKSHLQKYRL  240
HVRRLTESPP SSTSTWAQPP YGVINGLVMK PAGTGAHSNS PEGPLHLGLP ATTREVSVTV  300
TGLNAVEESE EEESVRGF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-34G2-like family protein