PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019171025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 486aa    MW: 52223 Da    PI: 7.2369
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019171025.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.4e-32265320156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_019171025.1 265 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 320
                     68****************************************************97 PP

2Myb_DNA-binding40.37.4e-13267318148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r  W+++++ ++v+a ++lGg    t+k I + m   g+t  ++ks++qky+
   XP_019171025.1 267 RRCWSPDLHRRFVNALQMLGGSqvaTPKQIRELMKvDGLTNDEVKSHLQKYR 318
                      568*****************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    
MMASPSELTL DCKPHTYSML LKSFGDHHLH PHHQNDQTLQ KLEDFLSRLE EERLKIDAFK  60
RELPLCMQLL TNAMEASKQQ LQSFRANNNN HGAARPVLEE FIPLKNSSSL EGTTDQKAAA  120
NATGDKANWM TTAQLWSQGN NNNNNNESSM QQKIPSKETE IGFSVSPNPQ MNNNGGAFLP  180
FSKDHRSGSC PSPTLALASP DGKELEEKKS LEINVNLGKC SNNGPATTEL GKSGDCGGGG  240
GGGATLPPPQ DSQTAAATAT QPHRKARRCW SPDLHRRFVN ALQMLGGSQV ATPKQIRELM  300
KVDGLTNDEV KSHLQKYRLH TRRPGPTPQA AAAAAPQLVV LGGIWVPPEY ATAAAAAHGG  360
AAAAAAATLY GAHPTTTHAH HPAPQHFSVG HEFYAAPTPP PPQHLPLHHH AGHPLHHQFH  420
MYKPPPHAQT SPESDGRGTG DRSESIEDGK SESGSWRADS GGEGRALAAL REDGEVSNGS  480
DITLKF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.17e-97G2-like family protein