PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019170620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 249aa    MW: 28739.6 Da    PI: 9.1253
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019170620.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-312074155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+Wt eLHe+Fv+av+qLGG++kAtPk+++++m++ gL+l+h+kSHLQkYR 
  XP_019170620.1 20 KPRLKWTAELHEAFVDAVQQLGGADKATPKSLMKAMNIRGLSLYHLKSHLQKYRH 74
                    79****************************************************6 PP

2Myb_DNA-binding591e-182273148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r++WT+e++e +vdav+qlGg    t+k+ ++ m+  g++l+++ks++qky+
   XP_019170620.1 22 RLKWTAELHEAFVDAVQQLGGAdkaTPKSLMKAMNiRGLSLYHLKSHLQKYR 73
                     89******************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    
MAPQSVQGNA MSLVLSREAK PRLKWTAELH EAFVDAVQQL GGADKATPKS LMKAMNIRGL  60
SLYHLKSHLQ KYRHGKSHQS RHSCHTRQQD YSEPRDQRSV AMQTQKNEKL QIDQALQVQM  120
EVQKKIHEQI EVQRHLQLRI EAQGKYLQSA LKKAQEILSK ADLISLLISP TMVDLGCQSS  180
SENSELTTME SCEEREERRY DKRFRGRRYD ETLKSSSGFL ENLDLNVKST VNKFDDTDCK  240
VIDLNREWV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.11e-57G2-like family protein