PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019162636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 356aa    MW: 39755.1 Da    PI: 9.8807
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019162636.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32173226255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_019162636.1 173 PRMRWTTTLHARFVNAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 226
                     9****************************************************7 PP

2Myb_DNA-binding49.21.3e-15174225148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWTt ++ ++v+av++lGg+   t+k++ + m  k +tl ++ks++q+y+
   XP_019162636.1 174 RMRWTTTLHARFVNAVELLGGHeraTPKSVLELMDvKDLTLAHVKSHLQMYR 225
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    
MELFPAQPDL SLRISPPNAK PSSSPWTTSK AQEHHHHGDV MDLSFWKRAL ETRNSMAKTE  60
SAINAASSSS SSFELSLSNP WSNTNRSSEH NGNINGGNNF AQFQFHQQQV GLGSELGFLR  120
PIRGIPVYCQ NPPSSPSSSS SQSHHHHRHH QALMRSRFLP AARFPARRSM RAPRMRWTTT  180
LHARFVNAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKAAVAASSG  240
QSEIFDNGSS GDTSEDVQTS RKSELSVQKG TQNMHNQDKD YHGLWCNFSS RESWLHGNPS  300
DCRGSTPFPT EKDKDPRLFG YERMSAEMNS SNITTTMETR SNKPNLEFTL GRPSGQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.18e-44G2-like family protein