PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019160991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 280aa    MW: 31459.6 Da    PI: 6.6041
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019160991.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like72.46.6e-23215264151
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                     kprl W+pe+H+rF +a+++L G++kA+Pk+i+elm+ +gLt+ehv+SHLQ
  XP_019160991.1 215 KPRLSWNPEMHQRFEQAINKL-GIDKAVPKKIVELMNEPGLTREHVASHLQ 264
                     79*******************.****************************9 PP

2Myb_DNA-binding30.77.5e-10217264145
                      TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHT.TTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..tWktIartmg.kgRtlkqcksrwq 45 
                      r++W +e ++++ +a+++lG +   +k+I + m+  g+t++++ s++q
   XP_019160991.1 217 RLSWNPEMHQRFEQAINKLGIDkaVPKKIVELMNePGLTREHVASHLQ 264
                      789*******************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    
MNDTQQGRLT SSGIPIHSSS SIPFHSPSSP SSDMGRICLL VFTDDFVCRN LVSEVLQHCS  60
YEVLHIGRAT DALGEIGKRR NGISFVLTNL NRLKTNGAEI IQTIEKELNL GVCLILPPSM  120
EFDTKGQECN VSSYILNFSD IREMKALWQS AFEKEKVRKP SAIRSPVMGV EIRIENNNEP  180
SVDGEPGNYN DHHNRRAKEV REKPNEESGG EKKKKPRLSW NPEMHQRFEQ AINKLGIDKA  240
VPKKIVELMN EPGLTREHVA SHLQLDLDET FIGKSLEGSE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.14e-32ARR-B family protein