PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019158288.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 352aa    MW: 39727.2 Da    PI: 9.2643
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019158288.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.5e-3184137255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      rlrWtpeLH++Fv+av++LGG++kAtPk + elm+vkg+ ++hvkSHLQ+YR+
  XP_019158288.1  84 RRLRWTPELHRCFVHAVQRLGGQDKATPKLVAELMNVKGINISHVKSHLQMYRS 137
                     69***************************************************7 PP

2Myb_DNA-binding49.11.3e-1585136148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT+e++  +v+av++lGg    t+k++a+ m+ kg    ++ks++q+y+
   XP_019158288.1  85 RLRWTPELHRCFVHAVQRLGGQdkaTPKLVAELMNvKGINISHVKSHLQMYR 136
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    
MMKEQKSSTQ VSQTEIPEIE SEEEEEEEEY SKESKKCGKR SDNGVVVSIS SSNNSTVEGD  60
NVKKTTNSSS SAGNVRPYKR STVRRLRWTP ELHRCFVHAV QRLGGQDKAT PKLVAELMNV  120
KGINISHVKS HLQMYRSKKA YEPNQATCDG GFLLDNEDHH VYNFSHFHRL HGFNQTPTPI  180
LRSEDGVIKI AGANYVYTKV AASNILRGSG FHGQNNITNY SLISSDFPMM FTQRFSSADE  240
TMSTPTPSSS TNLQQLHRHR TTDEGGERMG RIIKKRKFAE VNNLDLNLSL NSRINDEQRL  300
KYEDSNHSTK LCLSLYSSEG NHHHGIRRRR RRKQEEGTGM GGSSSCSLDL SL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1327332RRRRRR
2327333RRRRRRK
3327334RRRRRRKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.13e-38G2-like family protein