PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019152009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 401aa    MW: 46386.2 Da    PI: 9.3276
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019152009.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.82.9e-292882155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kpr +Wt + H rFv+av+qLGG+ kAtPk+i++lm+++ +t +h+kSHLQkYRl
  XP_019152009.1 28 KPRFKWTVQVHGRFVDAVNQLGGIYKATPKNIMRLMDIEQITTDHIKSHLQKYRL 82
                    79****************************************************8 PP

2Myb_DNA-binding34.35.4e-113281348
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     +WT + + ++vdav+qlGg    t+k I+r m  +  t  ++ks++qky+
   XP_019152009.1 32 KWTVQVHGRFVDAVNQLGGIykaTPKNIMRLMDiEQITTDHIKSHLQKYR 81
                     799999************88**************99*************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    
MMSTPGRNET KNEKNGQEVK QSLSGVRKPR FKWTVQVHGR FVDAVNQLGG IYKATPKNIM  60
RLMDIEQITT DHIKSHLQKY RLNGSKQANT NTRKSKKCFH EFSGELFKLL NSKHEEHSTY  120
KALYNIILNF RTMETAIRAT VFQRHQEHKY SITPGLHTMG IQVSDVPEIS TERQRTSQTK  180
LEFERAQQQV QYIEREYHGT LKQTSNNEKR QYPQVEEMEL TTEQLDEQRK MAQKDHISIL  240
NSDPLSSPME STNYIEPDYV GTTYSTLEIE RKNFLKPSYK RCLEAHKEKG KFPYTSARTD  300
DRELIIPEKK RFDAAPLKIS LQMEKGSTSS GFSADETHER GKCYQVYASP TSAAQIEAQN  360
MVAVDNKINM SNFPSYKDLK AMNASNEKSF DLNMPAKEQE E
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.27e-20G2-like family protein