PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN26496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 318aa    MW: 35548.1 Da    PI: 6.9836
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN26496.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.6e-51111371129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhP+deel+++yL k+++g  + +   + evd++kvePwd+p+++  ++kewyf+s+rd+kyatg r+nrat sgyWkatgkd++v++ kg+l
  PIN26496.1  11 LPPGFRFHPKDEELICDYLMKRIAGCAHLF-PLLIEVDLNKVEPWDIPETACVGSKEWYFYSQRDRKYATGLRTNRATVSGYWKATGKDRPVIQ-KGSL 107
                 79***********************99655.7799*************77777899**************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                 vg++ktLvfy+grapkg+ktdWvmhe+rle
  PIN26496.1 108 VGMRKTLVFYQGRAPKGRKTDWVMHEFRLE 137
                 ***************************985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    
MSSLSSVEAK LPPGFRFHPK DEELICDYLM KRIAGCAHLF PLLIEVDLNK VEPWDIPETA  60
CVGSKEWYFY SQRDRKYATG LRTNRATVSG YWKATGKDRP VIQKGSLVGM RKTLVFYQGR  120
APKGRKTDWV MHEFRLEGPG PKVASLGKED WVLCRVFFKS RSENPDTSQE TANYNNGTTC  180
FSSPLPPLTE PYITFDDTQA VPNNQYNEQV PCFSIFAASQ TSPNFSVVAH TDPPARIMPN  240
FGGIMSDFGS YNYSSSLMND PSSCDKKVIT AVLNHLTKVE SGNDPLISMR SSSSFGEGSS  300
DSYLSEVGLS CLWNNQYQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-100NAC family protein