PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN25289.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 531aa    MW: 58778.1 Da    PI: 4.3141
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN25289.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM97.32.2e-3048051128
         NAM  51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 +k+++++w+fFs+rd+ky++g r+nr  k+gyWkatgkd+ + + ++++vg+kktLvfy+grap+g +tdWvmhey++
  PIN25289.1   4 LKTGDRQWFFFSPRDRKYPNGARSNRGSKHGYWKATGKDRVISC-GSRAVGIKKTLVFYRGRAPSGDRTDWVMHEYTM 80 
                 567899********************99***************9.99*****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    
MSKLKTGDRQ WFFFSPRDRK YPNGARSNRG SKHGYWKATG KDRVISCGSR AVGIKKTLVF  60
YRGRAPSGDR TDWVMHEYTM DEEELKRCQT AKEYYALYKV YKKSGPGPKN GEQYGAPFRE  120
EDWADDELEV QCLVERENPV KGVNEVTPID NSKMVTFQYQ SSQDDLEEFL NQIVDEPIPI  180
PPLVVDHGYA PDQVAHEQEA RSALVDHSSW DVSSPVLQPF GQQPNLTASF DLTQSGTGQL  240
QLCEAPNISS ALAIHTQDPC ITEEDFLEDF LEMNDLLGAE LAVQNPDEPG NNLENLRFDD  300
FDGLHEFDLY QDASTFLCEV EPDESGQISG PCMNSLDNGF MSQISSTYLE NLENVTVNHQ  360
LLQQCNNANG ISYLMRTDEP SCTVVTATEA NQESVRSSTF MSGAVQQIQN HDFVVNHLAG  420
ANENGSGQQE DDGTDSWFSS ALWSFVESIP TTPASASEIA LANCAFEGMS SLSRVRINTR  480
SMNVAAGNAS ATSRNLGKSR TGFLCCSLLG VLCAVLWVLI GTSARVMGLY I
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-107NAC family protein