PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN25288.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 581aa    MW: 65163.4 Da    PI: 4.4937
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN25288.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.78.2e-52151412128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 ppGfrFhPtdeelv +yLk+k+  k++++ +vi e+d+yk+eP++Lp  +k+k+++++w+fFs+rd+ky++g r+nr t++gyWkatgkd+ + + +++
  PIN25288.1  15 PPGFRFHPTDEELVLYYLKRKICCKRHRI-DVIGETDVYKWEPEELPgiSKLKTGDRQWFFFSPRDRKYPNGARANRGTRHGYWKATGKDRVISC-GSR 111
                 9*************************999.99***************6559999****************************************9.99* PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +vg+kktLvfy+grap+ge+tdWvmhey++
  PIN25288.1 112 AVGIKKTLVFYRGRAPRGERTDWVMHEYTM 141
                 ****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    
MKVDADSFGN GDIFPPGFRF HPTDEELVLY YLKRKICCKR HRIDVIGETD VYKWEPEELP  60
GISKLKTGDR QWFFFSPRDR KYPNGARANR GTRHGYWKAT GKDRVISCGS RAVGIKKTLV  120
FYRGRAPRGE RTDWVMHEYT MDEEELKRCQ TAKEYYALYK VYKKSGPGPK NGEHYGAPFR  180
EEDWLDDELG VKCLPEQENP VKEGNEITTM DRTICEDQSS LDDLEEFLNQ IVDEHSPIQP  240
LVVDYGYSLD QVAGGEETQS TVVDHFSRDV SLPVTQPFSQ KPNAPASFDL TQSGTTQVQL  300
CEAPEVSSAT MSNVQDPRFT EEDFLEDFLE MDDLLGPDPT TQDPDKPVNN FEKVQFDEFA  360
GLNEFDLYQD ASSSLCPVAP VESRQISQPY MNNLDNGVVN PLSSSLMNNL ENTSANYLLQ  420
QQFNNDGISY ETWTDEQIYN GVNSAEANHG FIPASTSGVL HENQNNGFVN HSAGMIANGS  480
SKQDDGTDSW FSSALWSFVE SIPTTPASAS ESALVNRAFE RMSSFSRLRI NARNMNVAAG  540
NASATSRTVG IFRTSFIILS LLGVMCAIIW MLIGNSVRVM G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-137NAC family protein