PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN24577.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 247aa    MW: 28567.5 Da    PI: 6.6322
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN24577.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM103.42.9e-32281462128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv.ePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 p G+rF+Ptdeelv +yL++k+++ +l+  + i+evd+yk+  P+dL +    +k++e+ wyfF++ ++++          + gyWkat  d +v+s +
  PIN24577.1  28 PLGIRFRPTDEELVGYYLTRKIKNLELPPLTRIREVDLYKFaTPNDLAEryvLIKERERGWYFFTPGKSNH----------SGGYWKATAGDAPVYS-R 115
                 89************************999899********878****844556777889******976543..........48**************.9 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 g+ +g kktL fy+g +   +kt+W+mhe+r+
  PIN24577.1 116 GHIIGQKKTLCFYQGAKLA-KKTNWIMHEFRI 146
                 99***********887665.8*********97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    
MAGITVDSVM YKEDGQLMNE EEYIRSFPLG IRFRPTDEEL VGYYLTRKIK NLELPPLTRI  60
REVDLYKFAT PNDLAERYVL IKERERGWYF FTPGKSNHSG GYWKATAGDA PVYSRGHIIG  120
QKKTLCFYQG AKLAKKTNWI MHEFRINNEI WVLCKVFERN VGSNTTTSQR ATAEDFPNHA  180
TEEQQQNEEV LAAIVPAVVT NNANELQQPI ILEQNQEFLE STVHPCLIME INHYNRLIKT  240
HLSPILT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.17e-32NAC family protein