PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN24492.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 380aa    MW: 43015.2 Da    PI: 7.9766
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN24492.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.8e-53171441128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 + pGfrFhPtdeelv +yL++k+++++l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t sg+Wkatg+d++++s+ +++
  PIN24492.1  17 MLPGFRFHPTDEELVGFYLRRKLQQRSLPI-ELIKQVDIYKYDPWDLPKLAATGEKEWYFYCPRDRKYRNSTRPNRVTGSGFWKATGTDRPIYSSeGTK 114
                 579***************************.89***************8888899***************************************95666 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +glkk+Lvfy+gra kg+ktdW+mhe+rl
  PIN24492.1 115 CIGLKKSLVFYRGRAAKGVKTDWMMHEFRL 144
                 7***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    
MEEKINDGDK SAIDDIMLPG FRFHPTDEEL VGFYLRRKLQ QRSLPIELIK QVDIYKYDPW  60
DLPKLAATGE KEWYFYCPRD RKYRNSTRPN RVTGSGFWKA TGTDRPIYSS EGTKCIGLKK  120
SLVFYRGRAA KGVKTDWMMH EFRLPSTADG APAPPKKILD RNFPATDSWA ICRIFKKTTS  180
IAQRALSHSW TPPFSETSSP DPFTYTPKIT HFNSENEFQQ ANFSPLDIPS YKTTTAITGK  240
PPFLTSANAD NFNFPSNLVF SSPEEACNKN TVDLSSMLFN GCKNSDFEGP QQQFINGCSV  300
NSSLIMQGNV NGEDEQEGFR KNQSMTNLHT SWGNIRSMGF PFSLPSAETE SWNKTTLPWD  360
SPPCPSEISS TTYSTNKCYT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-100NAC family protein