PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN24079.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 381aa    MW: 43342.7 Da    PI: 7.1893
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN24079.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.5e-53181441128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 + pGfrFhPtdeelv +yL++k+++k+l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++s++++ 
  PIN24079.1  18 MLPGFRFHPTDEELVGFYLRRKIQQKPLSI-ELIKQLDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSTRPNRVTWAGFWKATGTDRPIYSEGSKC 115
                 579***************************.89***************8888999******************************************** PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 +glkk+Lvfykgra kg ktdW+mhe+rl
  PIN24079.1 116 IGLKKSLVFYKGRAAKGIKTDWMMHEFRL 144
                 ***************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    
MEERLVENDK SSTTDEVMLP GFRFHPTDEE LVGFYLRRKI QQKPLSIELI KQLDIYKYDP  60
WDLPKLATTG EKEWYFYCPR DRKYRNSTRP NRVTWAGFWK ATGTDRPIYS EGSKCIGLKK  120
SLVFYKGRAA KGIKTDWMMH EFRLPSVSDS VSSKKYLDKS IPPNEAWAIC RIFKKPNSST  180
QRTLTHSWVS PPFNHITTSN TTNPSSITNL HFNSTNLITT ANKTSSPLQF SFCNNIEQSS  240
IASFSPMKPF HQMYTDTPDS APPKRAINDA SSLLLDMSTS ILGESVRGSD NLDFSTLLDN  300
GFSTENVQEN LCHSEEGVLE KDQNAGELLD DQWGMMKSMG YYPYGFPFSL ADAWRPNLAW  360
DSPSPCPSEL STGYSTNKCH T
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-100NAC family protein